DPCfam | MC72131
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 91 |
|---|---|
| Mean domain length (aa) | 203 ± 17 aa |
| Residues in low-complexity regions (%) | 8.75 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 44.25 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF18702 |
| Sequences matching dominant architecture (%) | 7.81 |
| Average overlap percent | 79.98 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI00082B3DFB | 39-245 | 207 | LTACSAAVSGAPVPVGGTVSGHVATQLSTLLPDPATFPPTYQAIPLTGPALSAAAADLTGVPSGARVRPAGCAPSAPPAAADSTA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-K0F8R1-F1 | 29-235 | 99.51 | 91.89 | View in AlphaFoldDB ↗ |