DPCfam | MC72005
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 311 |
|---|---|
| Mean domain length (aa) | 190 ± 27 aa |
| Residues in low-complexity regions (%) | 1.66 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 27.05 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF10014 |
| Sequences matching dominant architecture (%) | 99.57 |
| Average overlap percent | 94.8 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A2SJH7 | 39-244 | 206 | LDAFDMMLPYWEELAPDLHLKDGGHYRYRRHGCFMQTLQPGQLETVQHRAHWQPTTYNALHGGMERWFEPLSNEMIHLPSWSALL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-K0F7U8-F1 | 21-224 | 97.98 | 94.19 | View in AlphaFoldDB ↗ |