DPCfam | MC71982
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 430 ± 27 aa |
| Residues in low-complexity regions (%) | 1.94 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 29.15 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF13365 |
| Sequences matching dominant architecture (%) | 72.5 |
| Average overlap percent | 38.54 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0S4HTW6 | 25-482 | 458 | DYGDNLQNLAASRVLKNIDGSQDHWQGIGRLEINGARCTATLLDTRDELASPPTPAYVLTAGHCIELTNGNIVTDKPVSGTMQFN... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A077ZA46-F1 | 39-139 | 21.46 | 78.12 | View in AlphaFoldDB ↗ |