DPCfam | MC71857
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 191 |
|---|---|
| Mean domain length (aa) | 85 ± 9 aa |
| Residues in low-complexity regions (%) | 1.43 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 18.66 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF07944 |
| Sequences matching dominant architecture (%) | 63.95 |
| Average overlap percent | 6.24 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A166MN91 | 30-117 | 88 | SNGLQPWLYTRFHPGAIKPTGWMLDQANIQANGLAGSTAENYSYVADSVWTGGTIEYSEMLEAAPYWFNGVVTLAYQLDDSRLKS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-C0NF87-F1 | 7-94 | 96.77 | 97.29 | View in AlphaFoldDB ↗ |