DPCfam | MC7171
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 131 |
|---|---|
| Mean domain length (aa) | 1108 ± 187 aa |
| Residues in low-complexity regions (%) | 2.16 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 20.7 |
| Average transmembrane regions | 0.04 |
| Dominant Pfam architecture(s) | PF15780 |
| Sequences matching dominant architecture (%) | 12.05 |
| Average overlap percent | 6.3 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI000A35597A | 290-1458 | 1169 | LHFGSVAVGCTAERQIKLYNPSAVNAPFKIEMAPDILDKDQAFSCSMGHGIVPPGEKKLVSMFFHPKTLDSRAVDYFSIMPSGSA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-F1P4W9-F1 | 282-1456 | 100.00 | 84.33 | View in AlphaFoldDB ↗ |