DPCfam | MC71491
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 1551 |
|---|---|
| Mean domain length (aa) | 73 ± 8 aa |
| Residues in low-complexity regions (%) | 1.31 |
| Residues in coiled-coil regions (%) | 0.02 |
| Predicted disordered residues (%) | 16.98 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF02463 |
| Sequences matching dominant architecture (%) | 71.24 |
| Average overlap percent | 6.51 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A2FBW6 | 436-527 | 92 | RQKINSDNQCKNRYNILDILQNPSNQISGIHGFLIQFVSSIRQKYDKAVSALLPSFSNLIVVDSKSVIKQCIKTLKTFNLSGVTF... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q59037-F1 | 521-586 | 95.65 | 89.46 | View in AlphaFoldDB ↗ |