DPCfam | MC71394
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 141 |
|---|---|
| Mean domain length (aa) | 140 ± 18 aa |
| Residues in low-complexity regions (%) | 0.84 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 14.3 |
| Average transmembrane regions | 0.07 |
| Dominant Pfam architecture(s) | PF01753 |
| Sequences matching dominant architecture (%) | 3.12 |
| Average overlap percent | 4.31 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0B7FX75 | 968-1101 | 134 | IFVLGLRLDLAGGTVVLDTALVPIHLKGSAEMSPALTILNNSGQALMQIRTRPNEVIAWKHLLPAFVERCRTWSHKPNCEYKATG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0D2G7X3-F1 | 1004-1143 | 100.00 | 94.16 | View in AlphaFoldDB ↗ |