DPCfam | MC71366
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 481 |
|---|---|
| Mean domain length (aa) | 68 ± 5 aa |
| Residues in low-complexity regions (%) | 3.97 |
| Residues in coiled-coil regions (%) | 0.21 |
| Predicted disordered residues (%) | 0.91 |
| Average transmembrane regions | 1.64 |
| Dominant Pfam architecture(s) | PF00520 |
| Sequences matching dominant architecture (%) | 72.29 |
| Average overlap percent | 17.69 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI000A2A8640 | 1-69 | 69 | MSWARKFYEFHRAPITKFWANLIIYFMFLALFSYIILLKLEPFPKLEEWILIGFVLTLLLEEIRQIVQS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-F1M7G0-F1 | 833-898 | 98.51 | 85.99 | View in AlphaFoldDB ↗ |