DPCfam | MC711
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 388 ± 75 aa |
| Residues in low-complexity regions (%) | 9.69 |
| Residues in coiled-coil regions (%) | 3.16 |
| Predicted disordered residues (%) | 25.14 |
| Average transmembrane regions | 0.04 |
| Dominant Pfam architecture(s) | PF00169 |
| Sequences matching dominant architecture (%) | 89.8 |
| Average overlap percent | 22.65 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| Q5F4B2 | 32-478 | 447 | LKVLSHNLCTVLNVPHDPVALEEHFRDDDEGPVSNQGYMPYLNKFILEKVQGNFDKVEFNRMCWTLCAKKNLSKSPLLISDEDAF... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9UH65-F1 | 10-370 | 85.44 | 87.65 | View in AlphaFoldDB ↗ |