DPCfam | MC7107
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 491 |
|---|---|
| Mean domain length (aa) | 76 ± 7 aa |
| Residues in low-complexity regions (%) | 0.4 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 11.5 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF08436- PF13288 |
| Sequences matching dominant architecture (%) | 95.32 |
| Average overlap percent | 33.53 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1R0IGX0 | 200-278 | 79 | MGAKITVDSATLMNKGLEIIEAHHLFDVTYDQIDVVIHPQSVVHSLVEFVDGATMAQLGWPDMAVPVQVALSWPERWPL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-B3QXY0-F1 | 202-278 | 98.72 | 97.55 | View in AlphaFoldDB ↗ |