DPCfam | MC70930
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 121 ± 7 aa |
| Residues in low-complexity regions (%) | 1.58 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 23.81 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF11886 |
| Sequences matching dominant architecture (%) | 95.83 |
| Average overlap percent | 47.23 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1U8LMS9 | 522-646 | 125 | TQGWDHDVGYEGVNVERSFMVKHKYPVSFSGQITKDKKDTNIQTELASSLKHGSGKATSLAFDMQTVGNDIYCTLCGETRFINFF... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-O81283-F1 | 1264-1384 | 100.00 | 83.20 | View in AlphaFoldDB ↗ |