DPCfam | MC70886
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 160 ± 4 aa |
| Residues in low-complexity regions (%) | 12.11 |
| Residues in coiled-coil regions (%) | 0.19 |
| Predicted disordered residues (%) | 4.14 |
| Average transmembrane regions | 3.97 |
| Dominant Pfam architecture(s) | PF07786 |
| Sequences matching dominant architecture (%) | 2.04 |
| Average overlap percent | 76.25 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A150AB99 | 1-163 | 163 | MDILKAATDWGRAEAFSISFFILFGILFIITGLGFWQLGKTEFARGFIYPISIAGIFMLVSGLGLFFSNKSRVASFESAYTEDAS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-O67827-F1 | 66-145 | 47.50 | 97.28 | View in AlphaFoldDB ↗ |