DPCfam | MC70689
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 268 ± 44 aa |
| Residues in low-complexity regions (%) | 1.07 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 25.64 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| G3I8U4 | 135-423 | 289 | GDGVVEGVIRYHPFLYDRETYPDDPSFPSKLRDEEDDDDCFIVERAARGKRPIFECFWNGRLIPYTSVEDFDWCAPPKKRGLAPI... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0G2L6F5-F1 | 445-685 | 99.59 | 82.11 | View in AlphaFoldDB ↗ |