DPCfam | MC70563
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 63 ± 6 aa |
| Residues in low-complexity regions (%) | 0.0 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 8.13 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF19030 |
| Sequences matching dominant architecture (%) | 86.11 |
| Average overlap percent | 17.81 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A091S5S1 | 807-881 | 74 | MCVEKPKPRENQKCGLQECRKSTGLPCSKDQLSVHFCQRLKGIGKCLLPSIQTQCCFTCSQPRIHNKARYGDQR... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q68SA9-F1 | 1581-1640 | 95.24 | 73.99 | View in AlphaFoldDB ↗ |