DPCfam | MC70507
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 531 |
|---|---|
| Mean domain length (aa) | 167 ± 23 aa |
| Residues in low-complexity regions (%) | 2.58 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 27.22 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF09423 |
| Sequences matching dominant architecture (%) | 99.76 |
| Average overlap percent | 44.37 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| K4R9P2 | 332-498 | 167 | DPALTMLGAEQKRWLLDGLHGSPARWNLIASQIMMAETDLLVGEGKQWFYDAWDGYQAERNQFLSEFKRVRNPVVLTGDRHLTMI... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q8KRU5-F1 | 349-526 | 97.59 | 89.44 | View in AlphaFoldDB ↗ |