DPCfam | MC70454
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 121 |
|---|---|
| Mean domain length (aa) | 88 ± 10 aa |
| Residues in low-complexity regions (%) | 1.49 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 10.5 |
| Average transmembrane regions | 0.67 |
| Dominant Pfam architecture(s) | PF04082 |
| Sequences matching dominant architecture (%) | 0.85 |
| Average overlap percent | 35.05 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A178DQ22 | 681-764 | 84 | MQTKLLAIPCAVERHNIFTMCIAAQIALVQISACTNLLEDHALSIARDRVRLSIGYLNTMGSVWPLGKKMAKEVRGIARTTLNR... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0D2DLA9-F1 | 438-531 | 98.95 | 90.48 | View in AlphaFoldDB ↗ |