DPCfam | MC70347
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 339 ± 44 aa |
| Residues in low-complexity regions (%) | 6.55 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 34.79 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF13620 |
| Sequences matching dominant architecture (%) | 30.3 |
| Average overlap percent | 17.86 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0G1SG56 | 1779-2177 | 399 | AGNELDGAWIQFVDQTNGVQFGTQATSTGGYSIKASNGTYQVLVSKPQYVATPVELTVSGTTTTNFIMSSAALTISGSVTAGGVA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-I1NBD7-F1 | 855-1016 | 48.28 | 87.26 | View in AlphaFoldDB ↗ |