DPCfam | MC70173
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 221 |
|---|---|
| Mean domain length (aa) | 241 ± 37 aa |
| Residues in low-complexity regions (%) | 1.06 |
| Residues in coiled-coil regions (%) | 2.22 |
| Predicted disordered residues (%) | 16.85 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI000947D57E | 162-400 | 239 | FVSVKLSAVKVDSRFTTTTQIIKLLSPHIISKIAVRLTDLKRTKMVRTVHIYYNNRTVPSIVELKNRQCMWHRAKKVVLSPGQTE... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A077ZBI3-F1 | 8-230 | 97.00 | 90.02 | View in AlphaFoldDB ↗ |