DPCfam | MC7017
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 124 ± 19 aa |
| Residues in low-complexity regions (%) | 0.42 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 9.32 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00094 |
| Sequences matching dominant architecture (%) | 86.84 |
| Average overlap percent | 18.17 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI00065B7CFB | 3521-3642 | 122 | IVFDPQRGELQVEVYLPFPLKSLAEVPKIKPGKYAAKLKELTQIELPTTDGMLWDTYYNYVPSVETSEWVPPFDGSAYLIGSQHY... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-E9Q0B5-F1 | 1246-1280 | 27.78 | 77.64 | View in AlphaFoldDB ↗ |