DPCfam | MC70134
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 322 ± 23 aa |
| Residues in low-complexity regions (%) | 1.65 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 17.12 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| E6X3S0 | 8-340 | 333 | SNVLFLDQQSEEPIIGLQIFSENGSFVANTNSKGVFELDIKMLQQGGVKSIIAYNTDYVSLEFKLNEVPSLVYLKRNEMIQLDPV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q8A1G1-F1 | 20-109 | 27.11 | 78.96 | View in AlphaFoldDB ↗ |