DPCfam | MC70053
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 131 |
|---|---|
| Mean domain length (aa) | 55 ± 5 aa |
| Residues in low-complexity regions (%) | 0.0 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 8.84 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF07800 |
| Sequences matching dominant architecture (%) | 96.19 |
| Average overlap percent | 45.97 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| Q7XP23 | 20-76 | 57 | ALHKEWDDALCPICMDHPHNAVLLLCSSHDKGCRSYICDTSYRHSNCLDRFKKMKVD... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q0JLA7-F1 | 49-103 | 91.67 | 91.75 | View in AlphaFoldDB ↗ |