DPCfam | MC69911
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 171 |
|---|---|
| Mean domain length (aa) | 452 ± 52 aa |
| Residues in low-complexity regions (%) | 11.53 |
| Residues in coiled-coil regions (%) | 0.33 |
| Predicted disordered residues (%) | 33.9 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF18325- PF18314 |
| Sequences matching dominant architecture (%) | 63.69 |
| Average overlap percent | 71.87 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A177VLW5 | 86-554 | 469 | AYQFASPVRWIETQDILFSPPYDFERLIEFGPSPTLVGMAQRTHKLKYAKADLARGKRRVMLCHGKDQEAICYSFADAEEDGSAT... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-C1GSN0-F1 | 6-509 | 100.00 | 81.90 | View in AlphaFoldDB ↗ |