DPCfam | MC69905
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 159 ± 12 aa |
| Residues in low-complexity regions (%) | 5.44 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 38.63 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0009734347 | 791-953 | 163 | LILTTDSCAGDMRKWDSPLLPFVPYPLSPLSTQPVPVRLRGLRPGQRLLLGGPMCDPETGLLVPILAVTIHPQTGLVYPLGGVHV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A1B0GT42-F1 | 741-902 | 100.00 | 86.99 | View in AlphaFoldDB ↗ |