DPCfam | MC69895
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 53 ± 6 aa |
| Residues in low-complexity regions (%) | 1.68 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 23.83 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00919 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 43.86 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| E6PXB3 | 41-102 | 62 | VVVNTCSVTAEADRDARAFVRRAHRLNPKARIVVTGCYAQRAPEQLAALDGVCAVVGNSHKA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P54462-F1 | 55-104 | 98.04 | 96.78 | View in AlphaFoldDB ↗ |