DPCfam | MC69641
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 191 |
|---|---|
| Mean domain length (aa) | 104 ± 11 aa |
| Residues in low-complexity regions (%) | 1.94 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 24.79 |
| Average transmembrane regions | 0.06 |
| Dominant Pfam architecture(s) | PF00027 |
| Sequences matching dominant architecture (%) | 93.17 |
| Average overlap percent | 12.07 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| U6NZ39 | 462-560 | 99 | RATTVLAIRFSQLARIPEGLLNFIKLQFPQVGFRLVQLLGQYYSSMHRRMPYLPTVSLEGTGDPMSHIKNLHTIAVVPASTEVPL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q6ZV29-F1 | 655-758 | 100.00 | 70.06 | View in AlphaFoldDB ↗ |