DPCfam | MC69545
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 81 |
|---|---|
| Mean domain length (aa) | 85 ± 9 aa |
| Residues in low-complexity regions (%) | 0.81 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 17.16 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | PF17851 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 44.85 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A084ZKS3 | 353-443 | 91 | LKERPGWLRLRGHESLSSHHYQSLLARRQTDFTFTAQTCVDFSPRSFQQMAGLVCFYDTTNYIYLNISCDEKGERTVNLMINDLN... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P77713-F1 | 358-442 | 98.84 | 98.02 | View in AlphaFoldDB ↗ |