DPCfam | MC69524
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 121 |
|---|---|
| Mean domain length (aa) | 87 ± 9 aa |
| Residues in low-complexity regions (%) | 2.77 |
| Residues in coiled-coil regions (%) | 0.82 |
| Predicted disordered residues (%) | 12.6 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF03063 |
| Sequences matching dominant architecture (%) | 89.19 |
| Average overlap percent | 37.24 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| E5VQ95 | 2-83 | 82 | MKKLWEEKEDIRSLKSLILFGLRGMAAYAYHAMVLGYSDQTVNRFFYEGMASIGYDLPKERLLSLALKLGEVNLQCMELLDK... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0Q355-F1 | 3-89 | 98.86 | 97.67 | View in AlphaFoldDB ↗ |