DPCfam | MC69236
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 191 |
|---|---|
| Mean domain length (aa) | 81 ± 7 aa |
| Residues in low-complexity regions (%) | 3.39 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 13.18 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | PF08623 |
| Sequences matching dominant architecture (%) | 99.43 |
| Average overlap percent | 28.69 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| Q2GWG1 | 1101-1184 | 84 | LSDTEMEIRRHAMSTLTSAAHNKPELILMYLNQLMPFVMNETVIKQELIREVQMGPFKHIIDDGLEVRKAAYETLYALMETAFS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A7MBJ5-F1 | 1010-1091 | 100.00 | 89.81 | View in AlphaFoldDB ↗ |