DPCfam | MC69034
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 151 |
|---|---|
| Mean domain length (aa) | 90 ± 9 aa |
| Residues in low-complexity regions (%) | 1.8 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 15.85 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0007A57D1F | 9-87 | 79 | IAGLKAKFAEHRIVFWHDPDKRFIEELEQLKLENVTLINMTHASQLAVKKRIEMDEPEQQFLLWFPHDAPPHEQDWLLD... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P0DUG0-F1 | 1-89 | 100.00 | 86.87 | View in AlphaFoldDB ↗ |