DPCfam | MC68933
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 121 |
|---|---|
| Mean domain length (aa) | 201 ± 26 aa |
| Residues in low-complexity regions (%) | 2.39 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 12.32 |
| Average transmembrane regions | 0.08 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| Q2W9I6 | 16-223 | 208 | LEAFLELMPEMGERLRVHRPQSNLVVNEDGDLDVEFRGEFLYGPGGRKRIEDMATRTALGPDHRISAAPLSSGHVDLIVKRFLYN... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-O25212-F1 | 16-190 | 84.39 | 93.22 | View in AlphaFoldDB ↗ |