DPCfam | MC68870
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 261 |
|---|---|
| Mean domain length (aa) | 263 ± 32 aa |
| Residues in low-complexity regions (%) | 2.51 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 8.16 |
| Average transmembrane regions | 0.24 |
| Dominant Pfam architecture(s) | PF14225 |
| Sequences matching dominant architecture (%) | 2.5 |
| Average overlap percent | 46.88 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0B2WP79 | 1627-1843 | 217 | LTSVLFDVCLIAAPSVDIANVWRARWMSLVASTAFQNNPAVQPRAFAVMGYLAREEVDDDLLYQVLVALRNSVSQFGEDGNSEML... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-U7PKF2-F1 | 1715-1995 | 97.86 | 76.55 | View in AlphaFoldDB ↗ |