DPCfam | MC68862
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 341 |
|---|---|
| Mean domain length (aa) | 252 ± 37 aa |
| Residues in low-complexity regions (%) | 8.09 |
| Residues in coiled-coil regions (%) | 0.05 |
| Predicted disordered residues (%) | 32.09 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF00816 |
| Sequences matching dominant architecture (%) | 0.42 |
| Average overlap percent | 12.15 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0004B9DF49 | 374-668 | 295 | FVGIDAEGTLLIDRGYVRPEDEVPASEPEQARSSEPDAAALDGAEPSAPVIQRAIITIGGKVAEPEDEDDDAVKPLPDRLLTELT... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0H3GWE9-F1 | 389-645 | 99.24 | 81.14 | View in AlphaFoldDB ↗ |