DPCfam | MC68772
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 81 |
|---|---|
| Mean domain length (aa) | 246 ± 47 aa |
| Residues in low-complexity regions (%) | 4.66 |
| Residues in coiled-coil regions (%) | 5.2 |
| Predicted disordered residues (%) | 30.98 |
| Average transmembrane regions | 0.1 |
| Dominant Pfam architecture(s) | PF05542- PF05542 |
| Sequences matching dominant architecture (%) | 84.29 |
| Average overlap percent | 96.44 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0M0JG34 | 1-304 | 304 | MRSFFAGASPEVSQAMRDAITSLLGSLPPLEFDARMTTTGDKLAALMLQLQMTGYMLRNAEYVMTLRRLLQLKTRSAAEYREAFA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A1D6KY93-F1 | 72-414 | 99.22 | 64.91 | View in AlphaFoldDB ↗ |