DPCfam | MC68725
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 221 |
|---|---|
| Mean domain length (aa) | 138 ± 13 aa |
| Residues in low-complexity regions (%) | 6.44 |
| Residues in coiled-coil regions (%) | 0.92 |
| Predicted disordered residues (%) | 17.43 |
| Average transmembrane regions | 1.93 |
| Dominant Pfam architecture(s) | PF18142 |
| Sequences matching dominant architecture (%) | 98.12 |
| Average overlap percent | 83.67 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1B7NA04 | 144-291 | 148 | DEKPRRLTIGERLNPSIINAEKERAQYAIKAQWTGYALNIAIGLQVLLGALTTGLSAALSGRQVSIGTALLGGMSTMVASYLARA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-U7PKG2-F1 | 190-321 | 93.57 | 55.69 | View in AlphaFoldDB ↗ |