DPCfam | MC68723
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 71 ± 8 aa |
| Residues in low-complexity regions (%) | 4.44 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 28.13 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00549 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 43.48 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI000B38BC16 | 438-510 | 73 | IGYGSHENPAHVAAEEVAQAKAILAEQGRQVIFIASICGTYEDMQDYATQKGLLEEQGVVVLESNAQAAQLAI... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P77187-F1 | 433-503 | 95.95 | 97.46 | View in AlphaFoldDB ↗ |