DPCfam | MC68496
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 311 |
|---|---|
| Mean domain length (aa) | 122 ± 11 aa |
| Residues in low-complexity regions (%) | 2.45 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 6.13 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF15998 |
| Sequences matching dominant architecture (%) | 98.38 |
| Average overlap percent | 90.08 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI00077A4AB0 | 40-208 | 169 | LKRHHCGCVKGHRACGCCLHLNLHPFHKKIQANVCINATEISSPLGMDFFMKWNKHVMFNKTITATDPPPVCFQTPLSKVGGKAC... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A044RZU6-F1 | 174-290 | 94.21 | 89.05 | View in AlphaFoldDB ↗ |