DPCfam | MC68349
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 181 |
|---|---|
| Mean domain length (aa) | 154 ± 14 aa |
| Residues in low-complexity regions (%) | 1.91 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 32.75 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF16678 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 93.08 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A034UZ84 | 6-157 | 152 | ELYILLKEAELYKFTPEELHAALKYCGPSVHPVQWLRDNWHKLIQTVQSLSTKYGQERVENIIGTVSQGEARDALRQHGGNIWQA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-E7F0V6-F1 | 450-614 | 99.35 | 84.24 | View in AlphaFoldDB ↗ |