DPCfam | MC68271
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 2761 |
|---|---|
| Mean domain length (aa) | 123 ± 14 aa |
| Residues in low-complexity regions (%) | 2.23 |
| Residues in coiled-coil regions (%) | 0.01 |
| Predicted disordered residues (%) | 22.29 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF02913 |
| Sequences matching dominant architecture (%) | 98.38 |
| Average overlap percent | 55.85 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| D8PGF7 | 384-515 | 132 | LYRFDPRKKPINFVDDVVVPATRISELIRYLETFFEGQHVPVAIFGHIGNGNAHITPLLDVNDRRDFDKMVQAYHEIHGAVLSRF... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q94AX4-F1 | 441-561 | 98.32 | 96.54 | View in AlphaFoldDB ↗ |