DPCfam | MC68255
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 91 |
|---|---|
| Mean domain length (aa) | 65 ± 6 aa |
| Residues in low-complexity regions (%) | 1.68 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 39.56 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF15445 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 19.05 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| Q8IBW9 | 1947-2016 | 70 | RDLHNGEEVTYNINLDDHKNMNFSTNHDNIPPKNNQNDLYTGIDLINDSISGNHNVDIYDELLKRKENEL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-O96110-F1 | 212-281 | 100.00 | 58.76 | View in AlphaFoldDB ↗ |