DPCfam | MC67979
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 241 |
|---|---|
| Mean domain length (aa) | 67 ± 10 aa |
| Residues in low-complexity regions (%) | 3.94 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 1.18 |
| Average transmembrane regions | 1.5 |
| Dominant Pfam architecture(s) | PF00375 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 19.54 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A090MN04 | 161-223 | 63 | IIPKSFLDPFVHGDILPVLFIAILLGVALSFAGERGKPIVSFLDSASVALFGMVRIIMYFAPI... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P96603-F1 | 133-206 | 98.67 | 92.43 | View in AlphaFoldDB ↗ |