DPCfam | MC6792
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 103 ± 5 aa |
| Residues in low-complexity regions (%) | 20.88 |
| Residues in coiled-coil regions (%) | 42.02 |
| Predicted disordered residues (%) | 22.91 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF13805 |
| Sequences matching dominant architecture (%) | 18.52 |
| Average overlap percent | 51.82 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1J8Q4B9 | 1-114 | 114 | MVHRPPDSRLLSNLIAHEKEYAKHLSALFPISHAALASLSAFAAASPSATPFSKSSVSLAQTIGAIVDILAGADDALQRYNQALE... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A1D8PDD1-F1 | 55-145 | 87.62 | 96.42 | View in AlphaFoldDB ↗ |