DPCfam | MC6784
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 81 |
|---|---|
| Mean domain length (aa) | 631 ± 100 aa |
| Residues in low-complexity regions (%) | 8.46 |
| Residues in coiled-coil regions (%) | 0.03 |
| Predicted disordered residues (%) | 63.22 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| D4B2C8 | 680-1239 | 560 | STRDRDQRLSVTASDPASTVPGSDNDTRIFSSGEEDETDCHSDTIFDSYPTRATSSNKSTSTPRGPRIDTIFDKPDVTPKQQQQQ... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A175W1G0-F1 | 505-1104 | 95.54 | 53.49 | View in AlphaFoldDB ↗ |