DPCfam | MC67726
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 171 |
|---|---|
| Mean domain length (aa) | 375 ± 50 aa |
| Residues in low-complexity regions (%) | 3.4 |
| Residues in coiled-coil regions (%) | 0.14 |
| Predicted disordered residues (%) | 14.37 |
| Average transmembrane regions | 0.06 |
| Dominant Pfam architecture(s) | PF00531 |
| Sequences matching dominant architecture (%) | 20.28 |
| Average overlap percent | 17.76 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1X7TDR1 | 92-550 | 459 | TKWQELGLRLGLLKTTLDAIEMKYRGDVYHCLTECLSQWLGRADNVDSRGGANLDSLSDALRSMNETAVAEKLKHHVLINIFDNR... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0R4IXF0-F1 | 120-187 | 17.94 | 85.28 | View in AlphaFoldDB ↗ |