DPCfam | MC6766
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 166 ± 37 aa |
| Residues in low-complexity regions (%) | 1.22 |
| Residues in coiled-coil regions (%) | 6.1 |
| Predicted disordered residues (%) | 24.05 |
| Average transmembrane regions | 0.1 |
| Dominant Pfam architecture(s) | PF00583 |
| Sequences matching dominant architecture (%) | 5.88 |
| Average overlap percent | 34.32 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A084DFL2 | 10-164 | 155 | TLTNGFVIVEQESLRGLNIGSLCFNEIVKWARRVAPEDHVMPIQLLGSHVGAYGRRNLERRHRFYQRFGLTFEFESGDVHPLASG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0H3H147-F1 | 96-224 | 79.04 | 85.18 | View in AlphaFoldDB ↗ |