DPCfam | MC67557
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 111 |
|---|---|
| Mean domain length (aa) | 86 ± 13 aa |
| Residues in low-complexity regions (%) | 7.53 |
| Residues in coiled-coil regions (%) | 7.64 |
| Predicted disordered residues (%) | 76.88 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF12796- PF12796 |
| Sequences matching dominant architecture (%) | 6.67 |
| Average overlap percent | 13.37 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI00072F6C9B | 511-595 | 85 | AELDLEMISEEAQEKLDGDENNHSRVQEEKKHESSEVEVSDNECDAADESGLIQQRKSGRNSSREFPAAENEDLDSLRTSFSISY... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A5A3E0-F1 | 376-470 | 97.85 | 31.87 | View in AlphaFoldDB ↗ |