DPCfam | MC67507
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 141 |
|---|---|
| Mean domain length (aa) | 142 ± 11 aa |
| Residues in low-complexity regions (%) | 2.17 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 18.51 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF12000 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 62.02 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| Q062Q5 | 1-136 | 136 | MKILILHPNFPGQFKHLCSFFENKGHDVRFICQTHYGRRIKGIKLIAVKHPMGHEHYIKISKSENKRVSLRADYYRSAFVKLNES... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q6ATD8-F1 | 579-606 | 19.18 | 93.85 | View in AlphaFoldDB ↗ |