DPCfam | MC67135
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 141 |
|---|---|
| Mean domain length (aa) | 502 ± 49 aa |
| Residues in low-complexity regions (%) | 2.95 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 32.17 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | PF09250- PF13481 |
| Sequences matching dominant architecture (%) | 58.59 |
| Average overlap percent | 89.72 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI00073E3CB7 | 5-489 | 485 | ALYYAKLGLPIFPVKHPSVPGQDHPGKEPWTEHGINDASSDLEKVAGWWDKHPNANIGLATGYNTSGLLVIDLDEDDEKNKHGLA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-K0F5S8-F1 | 20-286 | 51.71 | 92.47 | View in AlphaFoldDB ↗ |