DPCfam | MC67047
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 431 |
|---|---|
| Mean domain length (aa) | 175 ± 20 aa |
| Residues in low-complexity regions (%) | 3.72 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 17.71 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF08924 |
| Sequences matching dominant architecture (%) | 98.68 |
| Average overlap percent | 85.35 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A178JYF3 | 295-464 | 170 | TEVTSARAQTLKNAGYQTIGRYLSNVPGGLNKKIQPGELDAIFDAGLTVFPIFQTQGSRVEDFSYAQGMSAAAEAYQAANSYGFK... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-O31447-F1 | 293-476 | 97.73 | 92.61 | View in AlphaFoldDB ↗ |