DPCfam | MC66938
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 421 |
|---|---|
| Mean domain length (aa) | 222 ± 52 aa |
| Residues in low-complexity regions (%) | 1.25 |
| Residues in coiled-coil regions (%) | 0.03 |
| Predicted disordered residues (%) | 15.92 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | PF03175 |
| Sequences matching dominant architecture (%) | 1.38 |
| Average overlap percent | 6.73 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A7RWZ0 | 27-283 | 257 | FDINIDPXKPLSGSSYIPLPSELASKKAIINVKNESDHECFKWAVTSAIYPKETHPERLNKQMTESSKNFNWSGIEFPISLKQID... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q3SYV7-F1 | 383-428 | 17.46 | 88.43 | View in AlphaFoldDB ↗ |