DPCfam | MC66935
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 264 ± 45 aa |
| Residues in low-complexity regions (%) | 2.05 |
| Residues in coiled-coil regions (%) | 2.4 |
| Predicted disordered residues (%) | 16.85 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF13638 |
| Sequences matching dominant architecture (%) | 4.17 |
| Average overlap percent | 21.53 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0005D2BF85 | 627-843 | 217 | VVYRKPPWTLQDVLLCLKKHWIAVFGQLVQRKNLQLVLNLINFFHSRNSVDRSAASVALQDAKELVKAFRMRSSHVPRALSVMDS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q5T5J6-F1 | 607-887 | 100.00 | 79.45 | View in AlphaFoldDB ↗ |